PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008230970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 371aa    MW: 40703.5 Da    PI: 6.6415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008230970.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+ Ed +l+ +v ++G g+W++++++ g++R++k+c++rw +yl
   XP_008230970.1 14 RGIWTAAEDAKLLAYVSKHGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding47.63.8e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+e ++++++  G++ W++Ia+ ++ gRt++++k++w++
   XP_008230970.1  69 SFTPQEEEHIINLHEAIGSR-WSLIAKLLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.564965IPR017930Myb domain
SuperFamilySSF466892.23E-3111108IPR009057Homeodomain-like
SMARTSM007175.9E-151363IPR001005SANT/Myb domain
PfamPF002492.8E-151461IPR001005SANT/Myb domain
CDDcd001673.94E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2465116IPR009057Homeodomain-like
SMARTSM007174.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129417.64966116IPR017930Myb domain
PfamPF002491.1E-1369110IPR001005SANT/Myb domain
CDDcd001674.09E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGIWTAA EDAKLLAYVS KHGVGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF TPQEEEHIIN LHEAIGSRWS LIAKLLPGRT DNDVKNYWNT KLKKKLSKMG  120
IDPVTHKPFS QILSDYGNIS SLPSIDNQFG FFFKNSNNTF VPKSEPSSGI TGLPLGVNTY  180
SNMMMNPIGS DNSTASTLSL GIVAQFQEIN QDSVQVQPHF LNEVASSCSS SSSPHATDHQ  240
LSSQPIFLCQ QSLHEAQITP SSSFNWSEFL LHDPFSSADK LKQEQDFHGT MMSSSSVIPT  300
LAGGSELNLN ATTRACDFGS SAINIGGQRN NNLAHDQASS SSMTSFVDTI LGQDSEMQAA  360
FPELLDASFD Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230970.10.0PREDICTED: transcription repressor MYB6
TrEMBLM5XBU20.0M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-85MYB family protein